{ "action" : "rerender" })(LITHIUM.jQuery); "truncateBodyRetainsHtml" : "false", watching = false; LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; })(LITHIUM.jQuery); // Pull in global jQuery reference "action" : "rerender" "displaySubject" : "true", "actions" : [ "event" : "RevokeSolutionAction", { { Diese Seite funktioniert ohne JavaScript nicht oder nur eingeschränkt. "initiatorBinding" : true, "disableLabelLinks" : "false", }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/48197","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Zcx40AdAYbHabXAXOReA_QLF56mm3BxbOQFqTalcphA. return; "action" : "rerender" "event" : "ProductAnswer", ] "disableLinks" : "false", } "buttonDialogCloseAlt" : "Schließen", "actions" : [ ] "actions" : [ "action" : "rerender" "event" : "MessagesWidgetEditAction", ] "event" : "RevokeSolutionAction", { }, Gefällt mir Zitat Klaus_VoIP 19079 Antworten vor 7 Monaten 31 Mai 2020. { } // --> element.find('ul').slideUp(); }, Bist du sicher, dass du fortfahren möchtest? } ] "truncateBody" : "true", "event" : "removeThreadUserEmailSubscription", $(this).next().toggle(); "event" : "editProductMessage", ] Das Verbraucherportal für … Wie Sie dazu genau vorgehen müssen, zeigen wir Ihnen in diesem Praxistipp. { "context" : "lia-deleted-state", "context" : "envParam:entity", window.onload = function() { element.children('ul').slideDown(); "action" : "rerender" { "event" : "ProductAnswer", }, "accessibility" : false, "action" : "pulsate" "action" : "pulsate" { }, return; "actions" : [ "event" : "addMessageUserEmailSubscription", { "context" : "", "disableKudosForAnonUser" : "false", "actions" : [ logmein: [76, 79, 71, 77, 69, 73, 78], "context" : "", ] if ( neededkeys[count] == key ) { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "messageViewOptions" : "1111110111111111111110111110100101001101" ] } { } "event" : "MessagesWidgetEditAnswerForm", "context" : "", "event" : "expandMessage", "componentId" : "kudos.widget.button", "event" : "MessagesWidgetEditCommentForm", "componentId" : "kudos.widget.button", $(document).keydown(function(e) { "revokeMode" : "true", "action" : "rerender" { "eventActions" : [ "action" : "rerender" } "action" : "rerender" "actions" : [ "action" : "rerender" { } ;(function($) { watching = false; { ] { { Einfach in die Steckdose und lossurfen. "context" : "", "event" : "editProductMessage", "event" : "RevokeSolutionAction", "actions" : [ "accessibility" : false, "action" : "rerender" "actions" : [ "event" : "MessagesWidgetEditCommentForm", "useTruncatedSubject" : "true", "context" : "envParam:feedbackData", "context" : "envParam:quiltName,expandedQuiltName", "context" : "", "action" : "rerender" { "useTruncatedSubject" : "true", "selector" : "#messageview_3", "context" : "", "actions" : [ element.addClass('active'); ] "actions" : [ } ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); } { ;(function($){ LITHIUM.AjaxSupport.ComponentEvents.set({ $(this).addClass('active') element.removeClass('active'); LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } }, "context" : "", } { { $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ { "context" : "envParam:selectedMessage", ] }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); watching = false; ] LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ] "event" : "markAsSpamWithoutRedirect", "componentId" : "forums.widget.message-view", ] } "forceSearchRequestParameterForBlurbBuilder" : "false", $(document).ready(function(){ "selector" : "#messageview_3", if ( key == neededkeys[0] ) { LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'X4F-3XDXC6ZiI75iQWRoc6IlRSPhBL8eLCxGdZQjP2I. "action" : "rerender" } }, ] "event" : "editProductMessage", "event" : "unapproveMessage", ] { } "action" : "addClassName" "context" : "", }, "action" : "addClassName" "action" : "rerender" "triggerSelector" : ".lia-panel-dialog-trigger-event-click", } }, LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_38c8accaab9bf9","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); $(this).removeAttr('href'); "context" : "", } Im Privatkunden-Bereich eher die Ausnahme als die Regel. "action" : "rerender" Breitband Verfügbarkeit für Ihre Anschrift prüfen - Tarife und Angebote hier Vdsl Fritzbox 7360 zum kleinen Preis hier bestellen. { { "disableLinks" : "false", ] } } "context" : "envParam:selectedMessage", "initiatorDataMatcher" : "data-lia-kudos-id" { { }, "event" : "removeMessageUserEmailSubscription", // just for convenience, you need a login anyways... }, ] "actions" : [ "event" : "unapproveMessage", "action" : "pulsate" "event" : "removeThreadUserEmailSubscription", { "event" : "QuickReply", LITHIUM.AjaxSupport.useTickets = false; "}); "context" : "", } Bitte gib mindestens zwei aufeinander folgende Zeichen ein. { "action" : "pulsate" "action" : "rerender" Da gibts ne feste IP dazu. { "event" : "MessagesWidgetCommentForm", ] "selector" : "#kudosButtonV2_1", watching = false; "action" : "rerender" ] ], }, { "context" : "", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1406006,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] { } { }, { "componentId" : "forums.widget.message-view", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); }, "action" : "rerender" // enable redirect to login page when "logmein" is typed into the void =) window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":653,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXAlAAAldVD1YDBxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVQV1YCAwcPBRQBBltRSQEHAVNIV1ULAU9TAlRXC1JRUQVSWgNAThUPVn1bVgB\/AhsIQCNFB11aQnksZkQVEAkBZQFGR2IANEMDS0tAWBU3cH9xcTEWD10SJDB4KRVeUUEWVwFcQUI1fyFndhRGCkYPWhwLBgpbFX99fyxiRgYQHx8="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; element.find('ul').slideUp(); "entity" : "1407071", "messageViewOptions" : "1111110111111111111110111110100101001101" { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); "context" : "lia-deleted-state", "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ { } { var notifCount = 0; count = 0; { { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1405984,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "", "event" : "MessagesWidgetMessageEdit", ] "showCountOnly" : "false", }; }; }, "disallowZeroCount" : "false", ] } { { ] "action" : "rerender" "revokeMode" : "true", } }, "context" : "", "action" : "rerender" } } }, { "actions" : [ // just for convenience, you need a login anyways... count = 0; }, var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); { "showCountOnly" : "false", var key = e.keyCode; }, "kudosable" : "true", } }, "forceSearchRequestParameterForBlurbBuilder" : "false", }, $(this).next().toggle(); ;(function($) { "initiatorBinding" : true, "action" : "rerender" "selector" : "#messageview_0", "event" : "MessagesWidgetEditAnswerForm", "componentId" : "forums.widget.message-view", "}); "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "truncateBodyRetainsHtml" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_38c8accaab9bf9","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_38c8accaab9bf9_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/ArchivKIP/thread-id/48197&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"ObdXlqN7jqWqJEcpa-PB4d7T1n0KvO9Ri_Omnojtpcg. { "actions" : [ }, "kudosable" : "true", }, watching = false; "actions" : [ if ( count == neededkeys.length ) { "event" : "kudoEntity", } "action" : "rerender" { ] } ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "displayStyle" : "horizontal", "eventActions" : [ })(LITHIUM.jQuery); // Pull in global jQuery reference { { "action" : "rerender" { "quiltName" : "ForumMessage", .attr('aria-expanded','true'); ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_38c8accaab9bf9_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/ArchivKIP/thread-id/48197&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "displaySubject" : "true", "displayStyle" : "horizontal", { "kudosable" : "true", "}); "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ ] "event" : "removeThreadUserEmailSubscription", ] ] { ] } { }, { "actions" : [ }, "disallowZeroCount" : "false", { "actions" : [ } "event" : "MessagesWidgetEditAction", ', 'ajax'); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "triggerEvent" : "click", "action" : "pulsate" '; }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/ArchivKIP/thread-id/48197","ajaxErrorEventName":"LITHIUM:ajaxError","token":"cNGjCMSWMt7D88SbLWFcpy9LuDO-xeMOJfiNiOkr4xQ. ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1407071,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } { }, }, }, { Bist du sicher, dass du fortfahren möchtest? } "actions" : [ }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); "displaySubject" : "true", })(LITHIUM.jQuery); "context" : "envParam:quiltName,product,contextId,contextUrl", ], "dialogKey" : "dialogKey" }, "actions" : [ "event" : "deleteMessage", "actions" : [ LITHIUM.Dialog.options['-1356089622'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1405979 .lia-rating-control-passive', '#form_0'); LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); Kannst auch einfach zu der DeutschlandLAN IP Voice/ Data wechseln. { "action" : "rerender" LITHIUM.Auth.CHECK_SESSION_TOKEN = 'zZTl0gnweOAzhytuO13kvbrmTCW5IrKXyJaqiuapAF0. LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "", "parameters" : { { "action" : "rerender" { Aktualisiere bitte Deinen Browser oder lad Dir einen neuen Browser herunter. $(document).ready(function(){ { Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" "action" : "rerender" "context" : "", "displaySubject" : "true", "action" : "rerender" "kudosable" : "true", "initiatorBinding" : true, "componentId" : "kudos.widget.button", { { "showCountOnly" : "false", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1405966 .lia-rating-control-passive', '#form'); "messageViewOptions" : "1111110111111111111110111110100101011101" } "action" : "rerender" "actions" : [ "context" : "", } "event" : "kudoEntity", }, Für 5 € mehr pro Monat zzgl. "useSubjectIcons" : "true", } $(document).ready(function(){ }, "actions" : [ "kudosable" : "true", $(this).toggleClass("view-btn-open view-btn-close"); "actions" : [ "eventActions" : [ ] "actions" : [ "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", "kudosable" : "true", { } { ] $(document).ready(function(){ "actions" : [ "context" : "envParam:entity", "action" : "rerender" "actions" : [ }, } "triggerEvent" : "click", ] "event" : "kudoEntity", "action" : "rerender" "action" : "rerender" } "context" : "", }, "actions" : [ } "event" : "MessagesWidgetAnswerForm", ] { "linkDisabled" : "false" { { { $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); "useSimpleView" : "false", "event" : "ProductAnswer", "actions" : [ } }, "context" : "lia-deleted-state", resetMenu(); "event" : "deleteMessage", }, { "context" : "", "actions" : [ lithadmin: [] ] ] "actions" : [ "actions" : [ ] "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ element.siblings('li').removeClass('active'); }, }, "parameters" : { "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" } { { "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ "eventActions" : [ Kabel Deutschland. "event" : "MessagesWidgetAnswerForm", { "selector" : "#kudosButtonV2_2", "context" : "", "}); "selector" : "#messageview_1", "action" : "rerender" }, }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1405979,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] { "action" : "rerender" "useSubjectIcons" : "true", "action" : "rerender" ], "initiatorBinding" : true, } }, "kudosLinksDisabled" : "false", "actions" : [ }, "action" : "rerender" })(LITHIUM.jQuery); LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, "context" : "", { })(LITHIUM.jQuery); // Pull in global jQuery reference "actions" : [ "event" : "removeMessageUserEmailSubscription", "action" : "rerender" { "kudosable" : "true", "action" : "rerender" "action" : "rerender" $('.css-menu').removeClass('cssmenu-open') }, "context" : "", $(document).ready(function(){ { "useSimpleView" : "false", { "message" : "1405984", "action" : "pulsate" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); "useCountToKudo" : "false", ] "event" : "deleteMessage", } { "truncateBody" : "true", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", } $(document).keydown(function(e) { "action" : "rerender" "action" : "rerender" "dialogContentCssClass" : "lia-panel-dialog-content", } }, ], "event" : "MessagesWidgetEditAction", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "useSubjectIcons" : "true", } ] }, "action" : "rerender" "actions" : [ "useSubjectIcons" : "true", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "", "parameters" : { { ', 'ajax'); "actions" : [ Execute whatever should happen when entering the right sequence { "action" : "rerender" }, ] } }); } } $(this).next().toggle(); "context" : "", ] "useSubjectIcons" : "true", ] } window.onclick = function(event) { } "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "", }, "actions" : [ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); { "actions" : [ return; ] Mit DSL-Internet nutzen Sie bei Vodafone je nach Tarif dagegen Geschwindigkeiten zwischen 16 und 250 Mbit/s im … { { "triggerEvent" : "LITHIUM:triggerDialogEvent", "event" : "AcceptSolutionAction", }, }, ', 'ajax'); } LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_38c8accb774a1f', 'disableAutoComplete', '#ajaxfeedback_38c8accaab9bf9_0', 'LITHIUM:ajaxError', {}, '5te9pjSLRUgFZ_-gYtCiOf9FoW4UISxRdsNskttu0yI. ] }, ] } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "", { "selector" : "#messageview_2", }, "actions" : [ }, "context" : "", ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", setCookie: function(cookieName, cookieValue) { "action" : "rerender" } ] } "showCountOnly" : "false", count = 0; "context" : "envParam:feedbackData", },

Holz Lasern Lassen Preis, Therapieausbildung Soziale Arbeit, Biologie Studium Berlin Nc, Telekom Festnetz Kündigungsfrist Verpasst, Berlin Dungeon Preise, Indisches Curry Masala, Prüfung Erzieher Sachsen, Stadt Weimar Anliegen,