"action" : "rerender" } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "lia-deleted-state", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_2.lineardisplaymessageviewwrapper_0:renderinlineeditform?t:ac=board-id/Archiv/thread-id/273533","ajaxErrorEventName":"LITHIUM:ajaxError","token":"RVDOjwpTu_56frUZS58-MRCYdgHnDgA6yKLlJi9Ou8M. } { ] "actions" : [ "event" : "QuickReply", { "context" : "", "action" : "rerender" "context" : "", o.innerHTML = "Page must be an integer number. }, }, { Execute whatever should happen when entering the right sequence { "displayStyle" : "horizontal", { "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ "context" : "", }, "event" : "MessagesWidgetEditAction", "actions" : [ "actions" : [ "action" : "pulsate" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); "quiltName" : "ForumMessage", }, "action" : "rerender" { }, "action" : "pulsate" }, "event" : "ProductMessageEdit", }, "actions" : [ ] "actions" : [ "actions" : [ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); "action" : "rerender" { "action" : "rerender" "event" : "MessagesWidgetMessageEdit", var keycodes = { } }, { "initiatorDataMatcher" : "data-lia-kudos-id" ] } "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1463193,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "context" : "", "action" : "addClassName" "actions" : [ "event" : "MessagesWidgetEditCommentForm", "parameters" : { "; }); }, "event" : "addThreadUserEmailSubscription", "event" : "MessagesWidgetEditAnswerForm", }, count++; "eventActions" : [ ] ] $(document).ready(function(){ } Eine endgültige Umstellung des Internets auf IPv6 wird sich vermutlich noch lange hinziehen. } { { LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1463354,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { { "disableLabelLinks" : "false", "action" : "rerender" "event" : "removeMessageUserEmailSubscription", }, "context" : "", { { } "initiatorDataMatcher" : "data-lia-kudos-id" ] "useCountToKudo" : "false", "context" : "", "componentId" : "forums.widget.message-view", "action" : "rerender" "event" : "unapproveMessage", ] { { "displayStyle" : "horizontal", }, } { }, { { } LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); }, "linkDisabled" : "false" } { "event" : "editProductMessage", "quiltName" : "ForumMessage", ] "displaySubject" : "true", { Es sind schon seit mehreren Jahren alle IPv4-Blöcke vergeben - freie Blöcke bekommt man i.d.R. ] "actions" : [ "action" : "rerender" }, "context" : "", "action" : "rerender" .attr('aria-selected','true'); "context" : "envParam:selectedMessage", } else { "action" : "rerender" { "initiatorDataMatcher" : "data-lia-message-uid" }, } "parameters" : { { { } LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "initiatorBinding" : true, "messageViewOptions" : "1111110111111111111110111110100101001101" ] "actions" : [ ] "actions" : [ ] } { LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); ] "context" : "", ] "context" : "", "event" : "approveMessage", "actions" : [ { "action" : "rerender" } } "event" : "approveMessage", "context" : "envParam:quiltName,message", { "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); "action" : "rerender" { setWarning(pagerId); } "action" : "rerender" ] { { "event" : "addThreadUserEmailSubscription", } "action" : "rerender" "event" : "MessagesWidgetMessageEdit", "actions" : [ "action" : "rerender" "event" : "markAsSpamWithoutRedirect", "action" : "rerender" { $(document).ready(function(){ ] "useSimpleView" : "false", count++; "truncateBodyRetainsHtml" : "false", "actions" : [ ] { "; "includeRepliesModerationState" : "false", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, } "action" : "rerender" } "context" : "", } "context" : "envParam:quiltName", sollen bis zum Jahr 2020 mehr als 25 Milliarden Einzelgeräte mit dem Internet verbunden sein. }, { "truncateBody" : "true", { "event" : "kudoEntity", "actions" : [ "actions" : [ { "message" : "1465101", "actions" : [ "context" : "", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); // enable redirect to login page when "logmein" is typed into the void =) }, "event" : "deleteMessage", "action" : "rerender" } "action" : "rerender" "selector" : "#kudosButtonV2", "forceSearchRequestParameterForBlurbBuilder" : "false", { }, ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv/thread-id/273533","ajaxErrorEventName":"LITHIUM:ajaxError","token":"wO2CUGdgMct6EBCXvhxMUv9FgFWgfu4FOEThSY2F9Ro. LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } } LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'SbRhu5eLKqE1zRFvO66mkYnEaNKIvaAORJ0DxDdvZKE. }); }, { "componentId" : "forums.widget.message-view", }, ;(function($) { "context" : "envParam:quiltName", LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "event" : "markAsSpamWithoutRedirect", ] ] "actions" : [ ] { }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "messageViewOptions" : "1111110111111111111110111110100101101101" "actions" : [ } { "event" : "removeMessageUserEmailSubscription", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1463319,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] { ] ] Du wählst Deine Größe aus und legst die Karte ein. "action" : "rerender" "useCountToKudo" : "false", LITHIUM.AjaxSupport.fromForm('#form_9', 'GiveRating', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ ] }, }, } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1463359,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { { { "truncateBodyRetainsHtml" : "false", ] ] } ] } { "context" : "", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_35","feedbackSelector":".InfoMessage"}); "context" : "", { "actions" : [ } o.innerHTML = ""; { "context" : "", "action" : "rerender" "action" : "rerender" "action" : "rerender" "context" : "", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); } "action" : "rerender" } "action" : "rerender" "event" : "removeMessageUserEmailSubscription", "disallowZeroCount" : "false", "componentId" : "forums.widget.message-view", }, } { "disableKudosForAnonUser" : "false", "displayStyle" : "horizontal", { } { "event" : "addThreadUserEmailSubscription", ] }, "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "", "quiltName" : "ForumMessage", "actions" : [ "linkDisabled" : "false" }; ] LITHIUM.Dialog({ "eventActions" : [ } LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "event" : "MessagesWidgetEditCommentForm", } "disableKudosForAnonUser" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1463359 .lia-rating-control-passive', '#form_8'); "action" : "rerender" "quiltName" : "ForumMessage", "selector" : "#kudosButtonV2_0", { { { $(document).ready(function(){ } "action" : "rerender" }, "event" : "addMessageUserEmailSubscription", disableInput(pagerId); { "action" : "addClassName" { "truncateBodyRetainsHtml" : "false", "context" : "envParam:quiltName", $('.lia-autocomplete-footer').append(ctaHTML); }, "actions" : [ } "entity" : "1463365", { "event" : "ProductAnswer", }, { "truncateBodyRetainsHtml" : "false", "useTruncatedSubject" : "true", "context" : "", "action" : "rerender" "actions" : [ { LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" } } "event" : "ProductMessageEdit", } "context" : "envParam:quiltName,product,contextId,contextUrl", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "", "disableKudosForAnonUser" : "false", "actions" : [ { "event" : "editProductMessage", { ] "; }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); Das bedeutet, dass die Geräte nicht nur eine Anforderung an das Internet senden können, sondern auch zu jeder Zeit und grundsätzlich von jedem beliebigen Ort der Welt aus erreichbar sind und gesteuert werden können. { o.innerHTML = "Page must be in a numeric format. ] "action" : "rerender" { "actions" : [ "useCountToKudo" : "false", "action" : "rerender" { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; ] "event" : "QuickReply", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_54","feedbackSelector":".InfoMessage"}); "eventActions" : [ "event" : "kudoEntity", { "event" : "RevokeSolutionAction", "actions" : [ "actions" : [ "event" : "AcceptSolutionAction", }); "action" : "rerender" { "disableLabelLinks" : "false", ] }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); "actions" : [ }); "parameters" : { } "action" : "rerender" ] }, "actions" : [ "action" : "rerender" }, "event" : "kudoEntity", "useSimpleView" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); entdecken. "disableKudosForAnonUser" : "false", "context" : "", } "event" : "addThreadUserEmailSubscription", "action" : "rerender" { } "action" : "rerender" }, "action" : "rerender" "event" : "removeThreadUserEmailSubscription", "action" : "rerender" "action" : "pulsate" { } ;(function($) { "disallowZeroCount" : "false", "context" : "", "eventActions" : [ "event" : "ProductAnswer", }); "showCountOnly" : "false", "useCountToKudo" : "false", { } "parameters" : { { "actions" : [ { "context" : "", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_9', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } ] LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); return false; { "action" : "rerender" "selector" : "#messageview_4", "action" : "pulsate" "action" : "rerender" { } }, } resetMenu(); element.removeClass('active'); LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "parameters" : { "disableLabelLinks" : "false", "context" : "", "event" : "RevokeSolutionAction", }, } }, } ] "actions" : [ } "event" : "MessagesWidgetAnswerForm", return false;