{ { }, { if ( !watching ) { ] "event" : "QuickReply", ] { }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" }, ] } } "event" : "addThreadUserEmailSubscription", "componentId" : "forums.widget.message-view", "actions" : [ "actions" : [ "actions" : [ ] document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); } { ----------------- "kudosable" : "true", "context" : "", { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "context" : "", "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" "displaySubject" : "true", "context" : "envParam:quiltName,message", "actions" : [ "actions" : [ "context" : "", "actions" : [ "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "kudoEntity", "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", var neededkeys = [76, 79, 71, 77, 69, 73, 78]; { } Achtung, es folgt eine Signatur: Wenn überhaupt, dann jammern wir auf einem extrem hohen Niveau. LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); { ] { "action" : "pulsate" "useSimpleView" : "false", { "disableLabelLinks" : "false", }, }); ], ] "actions" : [ "displaySubject" : "true", Nur, wenn Vodafone die Leistung an deinem neuen Wohnort nicht anbietet, kannst du deinen Vertrag vorzeitig kündigen. "}); ] "defaultAriaLabel" : "", ] }, } { "event" : "ProductAnswerComment", ] "showCountOnly" : "false", { "message" : "767393", "context" : "envParam:entity", "context" : "", //$('#vodafone-community-header').css('display','block'); "event" : "MessagesWidgetAnswerForm", } { } "event" : "deleteMessage", LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); { { "actions" : [ "action" : "rerender" { } ], { { "actions" : [ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); ] "context" : "", LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); { Bleibt die Frage, warum der Anschluß vorzeitig abgeschaltet/der Vertrag vorzeitig beendet werden soll. { "kudosLinksDisabled" : "false", "selector" : "#kudosButtonV2_2", "actions" : [ } { "event" : "MessagesWidgetAnswerForm", { } "initiatorDataMatcher" : "data-lia-message-uid" "eventActions" : [ { "actions" : [ }, { ] } "context" : "envParam:selectedMessage", "actions" : [ { { })(LITHIUM.jQuery); { "context" : "", "event" : "removeMessageUserEmailSubscription", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_41","feedbackSelector":".InfoMessage"}); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } { "actions" : [ "componentId" : "kudos.widget.button", "actions" : [ var watching = false; }, ] "context" : "envParam:quiltName,message", } ] LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { ] "action" : "rerender" }, { "event" : "QuickReply", "defaultAriaLabel" : "", "action" : "rerender" ] "event" : "MessagesWidgetMessageEdit", } { "event" : "addThreadUserEmailSubscription", "event" : "addMessageUserEmailSubscription", "action" : "rerender" lithadmin: [] } { "event" : "addThreadUserEmailSubscription", "context" : "", } } }, "context" : "", { LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, '-5jKGHOcLg7OScnAPKnkcAvaHEkH0VxMGEF9oKhK-k8. ] } { "actions" : [ "displaySubject" : "true", "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] }, }, LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ }, Bist du sicher, dass du fortfahren möchtest? ] { { "componentId" : "kudos.widget.button", "selector" : "#messageview_5", "action" : "rerender" "action" : "pulsate" { } } "actions" : [ { } "context" : "envParam:quiltName,message,product,contextId,contextUrl", } "action" : "rerender" "action" : "rerender" function clearWarning(pagerId) { } Mit der automatischen Vorschlagsfunktion können Sie Ihre Suchergebnisse eingrenzen, da während der Eingabe mögliche Treffer angezeigt werden. { "event" : "markAsSpamWithoutRedirect", } clearWarning(pagerId); "context" : "", "kudosable" : "true", } } "action" : "rerender" "action" : "rerender" Bist du sicher, dass du fortfahren möchtest? "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "action" : "rerender" // We made it! }, } LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); { { }, "disableLinks" : "false", { "action" : "rerender" }, ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { }, "event" : "editProductMessage", Bei Ihrem Telefon- und Internet-Vertrag bei Vodafone haben Sie auch grundsätzlich die Möglichkeit, den Vertrag unter gewissen Umständen vorzeitig zu beenden. "event" : "RevokeSolutionAction", "kudosable" : "true", } ] "initiatorDataMatcher" : "data-lia-message-uid" }, "context" : "envParam:selectedMessage", "initiatorBinding" : true, { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.Dialog.options['-892400015'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; }, { ] "context" : "envParam:quiltName", "action" : "rerender" } { "event" : "MessagesWidgetEditAnswerForm", "useCountToKudo" : "false", "action" : "rerender" "event" : "removeThreadUserEmailSubscription", "}); "useSubjectIcons" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "disableKudosForAnonUser" : "false", "event" : "editProductMessage", "action" : "rerender" "selector" : "#kudosButtonV2_8", { } var clickHandler = function(event) { watching = true; "event" : "approveMessage", { ] "context" : "", { "context" : "", "event" : "ProductAnswerComment", "event" : "removeThreadUserEmailSubscription", ;(function($) { }, Und genau deswegen ist es wenig sinnvoll, substanzarm durch die Gegend zu spekulieren, sondern bedeutend zielführender, wenn der TE uns die genauen Infos liefert. "actions" : [ "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); "context" : "envParam:feedbackData", "actions" : [ }, clearWarning(pagerId); { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", sessionStorage.setItem("is_scroll", option); "event" : "deleteMessage", "context" : "", "context" : "", { clearWarning(pagerId); "actions" : [ { "initiatorDataMatcher" : "data-lia-kudos-id" } LITHIUM.Dialog({ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "revokeMode" : "true", "parameters" : { { "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'DKZMZrSTy6YyLjUeB9T-gnVtuiSJIhL8qln5yi-I3w0. { "event" : "QuickReply", ] "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ] lithadmin: [] "event" : "addThreadUserEmailSubscription", "action" : "rerender" "actions" : [ }, "linkDisabled" : "false" } ] "event" : "removeMessageUserEmailSubscription", "actions" : [ "action" : "rerender" } ] { // Oops, not the right sequence, lets restart from the top. "actions" : [ { "action" : "rerender" { "componentId" : "kudos.widget.button", { ] } { "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" Dann aber bitte nicht hier. "context" : "envParam:quiltName,message", "actions" : [ } }, "context" : "envParam:quiltName", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Dies ist beispielsweise der Fall, wenn Vodafone während der Laufzeit die Preise erhöht oder wenn dein Anschluss unberechtigterweise gesperrt wird. }); }, { "action" : "rerender" Doch kann es geschehen, dass Kunden mit dem Service des Dienstleisters nicht mehr zufrieden sind. "disableLabelLinks" : "false", "useSimpleView" : "false", "action" : "rerender" } LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); "event" : "kudoEntity", "}); } eine Ausgleichzahlung von mir verlangen, obwohl das hätte in der Kündigung stehen müssen oder in irgendeinem anderen SChreiben? { "context" : "envParam:entity", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-767407 .lia-rating-control-passive', '#form_7'); { ] { "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.Dialog.options['1434726774'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "linkDisabled" : "false" }); }, } "event" : "MessagesWidgetMessageEdit", "actions" : [ if ( watching ) { }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, "showCountOnly" : "false", "selector" : "#messageview_4", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "context" : "envParam:quiltName,message,product,contextId,contextUrl", "kudosLinksDisabled" : "false", { "action" : "rerender" var o = document.getElementById("custom_board_pagination_warning" + pagerId); } "initiatorBinding" : true, "eventActions" : [ }, > 0) ) "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "context" : "", } if ( key == neededkeys[0] ) { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "disableLabelLinks" : "false", { clearWarning(pagerId); "messageViewOptions" : "1111110111111111111110111110100101001101" "revokeMode" : "true", } }, "componentId" : "forums.widget.message-view", "action" : "rerender" }, "entity" : "767495", "event" : "kudoEntity", "context" : "", }, "action" : "rerender" "event" : "removeThreadUserEmailSubscription", "event" : "addThreadUserEmailSubscription", "includeRepliesModerationState" : "false", "event" : "removeThreadUserEmailSubscription", ] ;(function($) { }, "event" : "RevokeSolutionAction", "context" : "", }, "initiatorBinding" : true, }, // We made it! "actions" : [ "actions" : [ "revokeMode" : "true", "initiatorDataMatcher" : "data-lia-message-uid" { { ] "context" : "envParam:entity", { { { ] { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName", } Hallo, Mitte Juni habe ich bei Vodafone meinen DSL-Vertrag, der aktuell bis Mitte November läuft und sich danach automatisch um 1 Jahr verlängern würde, per Brief gekündigt. } "event" : "expandMessage", "actions" : [ "action" : "pulsate" "context" : "", ] "eventActions" : [ "action" : "pulsate" "useCountToKudo" : "false", clearWarning(pagerId); "action" : "rerender" } }); var key = e.keyCode; "action" : "rerender" { LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } } ;(function($) { ] Bist du sicher, dass du fortfahren möchtest? }, { "action" : "rerender" "event" : "MessagesWidgetAnswerForm", "componentId" : "kudos.widget.button", count = 0; "event" : "kudoEntity", "actions" : [ { } if ( Number(val) < 1 ) "action" : "rerender" { "actions" : [ "context" : "", Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" }, }, "actions" : [ }, "context" : "", .attr('aria-selected','true'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); Execute whatever should happen when entering the right sequence "context" : "", "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "pulsate" "selector" : "#messageview_6", "context" : "envParam:quiltName", LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, "parameters" : { { } } "action" : "rerender" } { "event" : "deleteMessage", { ] "action" : "rerender" "context" : "", { } "event" : "approveMessage", "messageViewOptions" : "1111110111111111111110111110100101001101" "actions" : [ } "event" : "AcceptSolutionAction", "actions" : [ "eventActions" : [ ] "event" : "removeMessageUserEmailSubscription", { { "action" : "rerender" "event" : "RevokeSolutionAction", { }, if (1 != val) "event" : "expandMessage", { }else{ if ( Number(val) < 1 ) "initiatorBinding" : true, }, "event" : "addThreadUserEmailSubscription", { { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_DSL/thread-id/37390","ajaxErrorEventName":"LITHIUM:ajaxError","token":"6TmfQglphEE3DQ3orJtpdO8UbJarOxPpvIAkPRKXD10. "context" : "envParam:selectedMessage", { { ] if ( Number(val) < 1 ) "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ "action" : "rerender" "event" : "addThreadUserEmailSubscription", "context" : "envParam:selectedMessage", "actions" : [ "actions" : [ "action" : "rerender" "context" : "", Da hilft am ehesten die Kontaktaufnahme zur Kundenbetreuung. "action" : "pulsate" "context" : "envParam:quiltName,message", ], { "useCountToKudo" : "false", "componentId" : "kudos.widget.button", } ] "actions" : [ }, "useSubjectIcons" : "true", "event" : "AcceptSolutionAction", "actions" : [ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); } "message" : "767495", } Du kannst deine außerordentliche Kündigung bei Vodafone per Post oder per Fax einreichen. "forceSearchRequestParameterForBlurbBuilder" : "false", } "actions" : [ { "disableLabelLinks" : "false", } ] }, "quiltName" : "ForumMessage", "initiatorDataMatcher" : "data-lia-kudos-id" }, { "action" : "rerender" LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234056}); { ], "action" : "rerender" ] { "actions" : [ "disableKudosForAnonUser" : "false", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ { { }, } { { return false; }, }, "context" : "", "action" : "rerender" "eventActions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101"