"disableLabelLinks" : "false", "}); ] } "actions" : [ } "truncateBody" : "true", "linkDisabled" : "false" "action" : "rerender" Vodafone Glas­faser erhalten in Hessen auch 7000 Haus­halte in der Kern­stadt von Fulda. "actions" : [ '; "action" : "rerender" { "event" : "removeMessageUserEmailSubscription", { "action" : "rerender" { // Oops. }, LITHIUM.AjaxSupport.ComponentEvents.set({ } "action" : "rerender" "actions" : [ "context" : "lia-deleted-state", LITHIUM.Dialog.options['272922879'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; Bist du sicher, dass du fortfahren möchtest? }); "useSimpleView" : "false", ] } { ] ;(function($) { "showCountOnly" : "false", ] { }, "useCountToKudo" : "false", ] "context" : "", }, }, ;(function($) { { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); // Oops, not the right sequence, lets restart from the top. "actions" : [ Achtung, es folgt eine Signatur: Wenn überhaupt, dann jammern wir auf einem extrem hohen Niveau. "truncateBodyRetainsHtml" : "false", { // Reset the conditions so that someone can do it all again. { LITHIUM.AjaxSupport.ComponentEvents.set({ }, { "context" : "", "context" : "", ] Wieso kann ich nicht GTA Online spielen und warum erhalte ich immer die Fehlermeldung „Für das Spielen von GTA Online benötigte Dateien konnten nicht vom Rockstar-Spieleservice heruntergeladen werden“. { { "disableKudosForAnonUser" : "false", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", element.siblings('li').children('ul').slideUp(); "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ "event" : "MessagesWidgetEditAnswerForm", var key = e.keyCode; watching = false; "actions" : [ // Oops, not the right sequence, lets restart from the top. { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); { { "event" : "ProductAnswer", } "event" : "unapproveMessage", "context" : "lia-deleted-state", "context" : "", "eventActions" : [ "selector" : "#kudosButtonV2_1", { { "dialogContentCssClass" : "lia-panel-dialog-content", } ] "event" : "approveMessage", "event" : "MessagesWidgetEditAction", { { "actions" : [ "linkDisabled" : "false" "actions" : [ } "actions" : [ // Oops, not the right sequence, lets restart from the top. { "context" : "envParam:feedbackData", .attr('aria-selected','false'); "action" : "rerender" "action" : "rerender" } element.removeClass('active'); "kudosable" : "true", "context" : "envParam:quiltName,message", } }, ] "context" : "envParam:quiltName,message", "entity" : "1587211", }, { "context" : "envParam:feedbackData", "event" : "MessagesWidgetCommentForm", { "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName", "actions" : [ ] $(document).ready(function(){ ] Hallo Telekom Team, habe seit eurer letzten Wartung seit ca. ] ], { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); { { // Set start to true only if the first key in the sequence is pressed "action" : "addClassName" ', 'ajax'); }, "action" : "pulsate" "disallowZeroCount" : "false", "action" : "rerender" "actions" : [ ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, '-ai13wRVtD3wzCw5XIiDUCYCF9-DWbwihA7JYscCzUQ. ] "initiatorDataMatcher" : "data-lia-message-uid" "context" : "", "kudosLinksDisabled" : "false", }, { "useSubjectIcons" : "true", }); }, } "event" : "MessagesWidgetMessageEdit", "action" : "addClassName" "event" : "addThreadUserEmailSubscription", { "useSubjectIcons" : "true", { if ( count == neededkeys.length ) { "actions" : [ } "useSubjectIcons" : "true", LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); "context" : "", }, "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/95819","ajaxErrorEventName":"LITHIUM:ajaxError","token":"G814E8nl8xCRZHjrlS-C_1gWrXP8VFzTRJh_lRmsrKs. "event" : "MessagesWidgetAnswerForm", } "buttonDialogCloseAlt" : "Schließen", { } "context" : "", }, } } "componentId" : "kudos.widget.button", "event" : "approveMessage", $(document).ready(function(){ } ] } ;(function($) { "actions" : [ "useCountToKudo" : "false", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { } { ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); } "context" : "", // Oops. ] { { "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "componentId" : "kudos.widget.button", "}); } "event" : "kudoEntity", } ] }, { "context" : "envParam:quiltName,product,contextId,contextUrl", }, "event" : "expandMessage", ], { $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { }, { { "useTruncatedSubject" : "true", "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ $(document).keydown(function(e) { "event" : "addThreadUserEmailSubscription", LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. function createStorage(option){ "context" : "lia-deleted-state", "context" : "envParam:quiltName,message,product,contextId,contextUrl", } "action" : "rerender" }, { "kudosable" : "true", { "action" : "rerender" "context" : "envParam:selectedMessage", "event" : "kudoEntity", "linkDisabled" : "false" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/34885","ajaxErrorEventName":"LITHIUM:ajaxError","token":"BvFgDPZgrvDTUqFtupyF0xUmsRgjqC25w9EXbU92-MY. ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "linkDisabled" : "false" "initiatorDataMatcher" : "data-lia-message-uid" { { "event" : "unapproveMessage", LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, '-ai13wRVtD3wzCw5XIiDUCYCF9-DWbwihA7JYscCzUQ. } { "event" : "MessagesWidgetMessageEdit", "useCountToKudo" : "false", "disableKudosForAnonUser" : "false", ] "context" : "", { }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/34885","ajaxErrorEventName":"LITHIUM:ajaxError","token":"zhj1DGIiLBmCBjd5gNRB-4J8HfItsTB6PKmFrHwPs0Q. "includeRepliesModerationState" : "false", "linkDisabled" : "false" //var height = $(window).scrollTop(); "context" : "envParam:quiltName", }); "context" : "", } }, { "context" : "envParam:selectedMessage", lithstudio: [], { "context" : "envParam:feedbackData", LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'yIbBSosb5iVA7z2rrCDxBhbZbKpA4ZRix-O-xgNCDhE. "useSubjectIcons" : "true", "context" : "", { "event" : "ProductMessageEdit", { }, var watching = false; "event" : "ProductMessageEdit", } }); ] }, "}); }); } { LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); } "selector" : "#kudosButtonV2", { "event" : "editProductMessage", LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, } if ( key == neededkeys[0] ) { {